PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID cra_locus_7162_iso_3
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Gentianales; Apocynaceae; Rauvolfioideae; Vinceae; Catharanthinae; Catharanthus
Family BES1
Protein Properties Length: 192aa    MW: 21934.8 Da    PI: 8.731
Description BES1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
cra_locus_7162_iso_3genomeMPGR-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF822120.91.7e-3736109376
                              DUF822   3 sgrkptwkErEnnkrRERrRRaiaakiyaGLRaqGnyklpkraDnneVlkALcreAGwvvedDGttyrkgskpl 76 
                                         + r p++kEr nnk+RER+RRai+  i+aGLRa+Gny+lpk  D n+ l+ALc+eAGw ve+DGt yrk + p+
  cra_locus_7162_iso_3_len_768_ver_3  36 KLRFPSEKERLNNKQRERKRRAITHNIFAGLRAHGNYQLPKNPDSNDLLRALCEEAGWHVEEDGTIYRKVTWPP 109
                                         6799*****************************************************************98887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF056871.7E-3437110IPR008540BES1/BZR1 plant transcription factor, N-terminal
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045492Biological Processxylan biosynthetic process
GO:0005794Cellular ComponentGolgi apparatus
GO:1990538Molecular Functionxylan O-acetyltransferase activity
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MGEEYERNSV LRGCIKKTKG PWVVRRATKN RGTVTKLRFP SEKERLNNKQ RERKRRAITH  60
NIFAGLRAHG NYQLPKNPDS NDLLRALCEE AGWHVEEDGT IYRKVTWPPF SLFPSPVVIF  120
GFKNLILASI FXQEPALKAP NLMEMDSSFQ ALVDDQNYCT CEDKKMESEF VADFCQKSSL  180
GAGNDTDLTL SI
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095225.14e-53PREDICTED: beta-amylase 7-like
TrEMBLA0A068UD634e-54A0A068UD63_COFCA; Uncharacterized protein